PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G05450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 561aa    MW: 59652.1 Da    PI: 4.6242
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G05450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM79.48.2e-25281641127
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleev..ikevdiykvePwdLpk.....kvkaeekewyfFskrdkkya....tgkrknr.atksgy 82 
                      lppG+ F+Pt ee +++yL++ ++gk++++ e+  ++ +d+y   P  L++        +   +w+f s+r+++++     +kr++r +++ g+
  OGLUM12G05450.1  28 LPPGVYFNPTREEAMHHYLNRWIAGKTIPEMEAgfVAGADVYGDGPDALRRrhrpgYWCNYVYKWFFLSHRKRQSSrrttGNKRAERvVAAGGR 121
                      79*************************777664459999**********85345542222445899999998887744423458888667799* PP

              NAM  83 WkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                      Wk     k+vl  +g   g +++Lvfy+ ++ k +kt+W+m+ey+
  OGLUM12G05450.1 122 WKVEQG-KKVLG-GGGGGGERDSLVFYSSNSTKESKTSWIMEEYT 164
                      **6544.68888.88899**************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-2524185IPR003441NAC domain
PROSITE profilePS5100531.37128185IPR003441NAC domain
PfamPF023652.8E-1629164IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MDVDPPPLPL PPPPPPPATP QQNTAVELPP GVYFNPTREE AMHHYLNRWI AGKTIPEMEA  60
GFVAGADVYG DGPDALRRRH RPGYWCNYVY KWFFLSHRKR QSSRRTTGNK RAERVVAAGG  120
RWKVEQGKKV LGGGGGGGER DSLVFYSSNS TKESKTSWIM EEYTSSVADG EEGRMESVLC  180
KIYLSPRAPA GEKRALFGED GVAVGPDGRK RNARVTVLAT LFDDVATLLG QPVAAAPPLP  240
APGDQLGHGH FDDVAARFGQ VAVAALPASG DLGHGYFDDD AAALFGQVAM APAPAPGHHQ  300
QGNVVAEALP ESGYLGHYHH DGHLAQAAAP EQDHYLGYHS HDAHVAEATP EQGYLGHHQG  360
HLAAAAADQD YHDDAHGDLG HDQGHFAAAL TPEECDEIVG AYEFHPEMVQ MLSMGFAVPD  420
EQLVPQLLDA TGGGYDMASS ATAAAAAAPT PRIRPNAAEA MAATATAETM PPPLDAVAAE  480
LFAPPRGLPP ELAFSALPSV QQEPSCDDDD NFGEVVAEAM PPLIGENAGV DAGSDEPLPD  540
LSGIMPELDF GHDFFSNQRR E
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A2e-132418316166NAC domain-containing protein 19
3swm_B2e-132418316166NAC domain-containing protein 19
3swm_C2e-132418316166NAC domain-containing protein 19
3swm_D2e-132418316166NAC domain-containing protein 19
3swp_A2e-132418316166NAC domain-containing protein 19
3swp_B2e-132418316166NAC domain-containing protein 19
3swp_C2e-132418316166NAC domain-containing protein 19
3swp_D2e-132418316166NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126200.0CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A0E0BPR70.0A0A0E0BPR7_9ORYZ; Uncharacterized protein
STRINGORGLA12G0043800.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135701724
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55210.14e-15NAC domain containing protein 63